by RL Beard · 1999 · Cited by 10 — There are two primary reasons for developing retinoic acid receptor (RAR) subtype-selective agonists and antagonists. ... Download to read the full chapter text.
Download-378 397 rar
by M Hu · Cited by 16 — Two coders examined the 378 unique changes and coded each of them to ... Sentiment lexicon. http://www.cs.uic.edu/~liub/FBS/opinion-lexicon-English.rar. Ac-.. ... >g378 MAPAAIPAEQYKNEQTDASNAKEKTPLEAISHGGIVMPGIPTFPSHTLHRQHILVHTAAVFRDFARRGFTEGMSGHISVRDPEFPSYIWMNPLGRHFGLM ... 3925e8d270
Commenti